PDB entry 1v08

View 1v08 on RCSB PDB site
Description: crystal structure of the zea maze beta-glucosidase-1 in complex with gluco-tetrazole
Class: hydrolase
Keywords: beta-glucosidase, glycoside hydrolase, dimboa-glucoside, inhibitor, pest defense, family gh1, hydrolase, chloroplast, transit peptide, 3d-structure
Deposited on 2004-03-25, released 2004-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49235
      • engineered mutation (190)
    Domains in SCOPe 2.07: d1v08a_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49235
      • engineered mutation (190)
    Domains in SCOPe 2.07: d1v08b_
  • Heterogens: NTZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v08A (A:)
    sarvgsqngvqmlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnh
    perildgsnsdigansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgik
    yyrnlinlllengiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfg
    dkvknwltfndpqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahae
    avdlynkhykrddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypf
    smrslarerlpffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasq
    evngpdgkpigppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplp
    meaalndykrldyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdr
    nnnctrymkesakwlkefntakkpskkiltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v08A (A:)
    mlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsd
    igansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinllle
    ngiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfnd
    pqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykr
    ddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlp
    ffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpig
    ppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrl
    dyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkes
    akwlkefntak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v08B (B:)
    sarvgsqngvqmlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnh
    perildgsnsdigansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgik
    yyrnlinlllengiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfg
    dkvknwltfndpqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahae
    avdlynkhykrddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypf
    smrslarerlpffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasq
    evngpdgkpigppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplp
    meaalndykrldyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdr
    nnnctrymkesakwlkefntakkpskkiltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v08B (B:)
    mlspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsd
    igansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinllle
    ngiepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfnd
    pqtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykr
    ddtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlp
    ffkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpig
    ppmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrl
    dyiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkes
    akwlkefntak