PDB entry 1v07

View 1v07 on RCSB PDB site
Description: crystal structure of thre11val mutant of the nerve tissue mini-hemoglobin from the nemertean worm cerebratulus lacteus
Class: oxygen transport
Keywords: oxygen transport, oxygen affinity of c.lacteus mini-hemoglobin, nerve tissue mini-hemoglobin
Deposited on 2004-03-24, released 2004-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17025
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neural hemoglobin
  Species: CEREBRATULUS LACTEUS [TaxId:6221]
  Database cross-references and differences (RAF-indexed):
  • PDB 1V07 (0-0)
    • engineered mutation (48)
  • Uniprot O76242 (1-109)
  Domains in SCOPe 2.07: d1v07a_
• Heterogens: HEM, OXY, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v07A (A:)
  mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagkvvdyinaaiggs
  adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl