PDB entry 1v06

View 1v06 on RCSB PDB site
Description: axh domain of the transcription factor hbp1 from m.musculus
Class: DNA-binding protein
Keywords: DNA-binding protein, transcription factor, protein-protein interaction, nucleic acid binding, ob-fold, ataxin-1 homologous, repressor, transcription, transcription regulation, wnt signaling pathway
Deposited on 2004-03-24, released 2005-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HMG box-containing protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V06
    • Uniprot Q8R316 (4-141)
    Domains in SCOPe 2.08: d1v06a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v06A (A:)
    gamapstiwhcflkgtrlcfhkesnkewqdvedfaraascdneeeiqmgthkgygsdglk
    llsheesvsfgesvlkltfdpgtvedglltveckldhpfyvknkgwssfypsltvvqhgi
    pcceihigdvclppghpdainf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v06A (A:)
    pstiwhcflkgtrlcfhkesnkewqdvedfaraascdneeeiqmgthkgygsdglkllsh
    eesvsfgesvlkltfdpgtvedglltveckldhpfyvknkgwssfypsltvvqhgipcce
    ihigdvclppghpdainf