PDB entry 1v05

View 1v05 on RCSB PDB site
Description: dimerization of human filamin c: crystal structure of the domain 24
Class: actin-binding protein
Keywords: actin-binding protein, immunoglobulin
Deposited on 2004-03-22, released 2004-11-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.18771
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: filamin c
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1v05a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v05A (A:)
amgsdaskvvtrgpglsqafvgqknsftvdcskagtnmmmvgvhgpktpceevyvkhmgn
rvynvtytvkekgdyilivkwgdesvpgspfkvkvp