PDB entry 1v04

View 1v04 on RCSB PDB site
Description: serum paraoxonase by directed evolution
Class: hydrolase
Keywords: paraoxonase, hydrolase, directed evolution, antioxidant, israel structural proteomics center, ispc, structural genomics
Deposited on 2004-03-22, released 2004-04-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum paraoxonase/arylesterase 1
    Species: RATTUS RATTUS [TaxId:10117]
    Database cross-references and differences (RAF-indexed):
    • GB AAR95984 (Start-354)
    Domains in SCOPe 2.07: d1v04a_
  • Heterogens: CA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v04A (A:)
    makltaltllgmglalfdrqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpn
    glafissglkypgimsfdpdksgkillmdlnekepavseleiigntldissfnphgistf
    idddntvyllvvnhpgssstvevfkfqeeeksllhlktirhkllpsvndivavgpehfya
    tndhyfidpylkswemhlglawsfvtyyspndvrvvaegfdfanginispdgkyvyiael
    lahkihvyekhanwtltplrvlsfdtlvdnisvdpvtgdlwvgchpngmriffydaenpp
    gsevlriqdilseepkvtvvyaengtvlqgstvaavykgklligtvfhkalycdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v04A (A:)
    lfdrqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpnglafissglkydksg
    killmdlnekepavseleiigntldissfnphgistfidddntvyllvvnhpgssstvev
    fkfqeeeksllhlktirhkllpsvndivavgpehfyatndhyfidpylkswemhlglaws
    fvtyyspndvrvvaegfdfanginispdgkyvyiaellahkihvyekhanwtltplrvls
    fdtlvdnisvdpvtgdlwvgchpngmriffydaenppgsevlriqdilseepkvtvvyae
    ngtvlqgstvaavykgklligtvfhkalycdl