PDB entry 1v03

View 1v03 on RCSB PDB site
Description: crystal structure of the sorghum bicolor dhurrinase 1
Class: hydrolase
Keywords: hydrolase, beta-glucosidase, dhurrin hydrolysis, pest defense, family gh1
Deposited on 2004-03-22, released 2004-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dhurrinase
    Species: SORGHUM BICOLOR MILO [TaxId:4558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41290
      • conflict (202)
      • conflict (211-213)
      • engineered mutation (239)
    Domains in SCOPe 2.07: d1v03a_
  • Heterogens: BGC, CCN, IPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v03A (A:)
    malllasainhtahpaglrshpnnesfsrhhlcsspqniskrrsnlsfrpraqtissesa
    gihrlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrs
    ngdvaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekgveyynklidl
    llengiepyitifhwdtpqalveayggflderiikdytdfakvcfekfgktvknwltfnd
    petfcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkg
    adgriglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvp
    yfkekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaig
    pptgnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldy
    iqrhlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsar
    wlqefngaakkvennkiltpagqln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v03A (A:)
    ihrlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrsn
    gdvaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekgveyynklidll
    lengiepyitifhwdtpqalveayggflderiikdytdfakvcfekfgktvknwltfndp
    etfcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkga
    dgriglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvpy
    fkekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaigp
    ptgnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldyi
    qrhlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsarw
    lqefnga