PDB entry 1v00

View 1v00 on RCSB PDB site
Description: erythrina cristagalli lectin
Class: lectin
Keywords: lectin, non-canonical dimer, carbohydrate-binding
Deposited on 2004-03-21, released 2004-06-22
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.172
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin (ecl)
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1v00a_
  • Chain 'B':
    Compound: lectin (ecl)
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1v00b_
  • Chain 'C':
    Compound: lectin (ecl)
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1v00c_
  • Chain 'D':
    Compound: lectin (ecl)
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1v00d_
  • Heterogens: LAT, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v00A (A:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v00A (A:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v00B (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v00B (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v00C (C:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v00C (C:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v00D (D:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v00D (D:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet