PDB entry 1uzz

View 1uzz on RCSB PDB site
Description: erythrina cristagalli bound to n-linked oligosaccharide and lactose
Class: lectin
Keywords: lectin, carbohydrate binding
Deposited on 2004-03-20, released 2004-06-22
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin (ecl)
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uzza_
  • Chain 'B':
    Compound: lectin (ecl)
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uzzb_
  • Chain 'C':
    Compound: lectin (ecl)
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uzzc_
  • Chain 'D':
    Compound: lectin (ecl)
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uzzd_
  • Heterogens: CA, MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzzA (A:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzzA (A:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uzzB (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzzB (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uzzC (C:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzzC (C:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uzzD (D:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzzD (D:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    n