PDB entry 1uzy

View 1uzy on RCSB PDB site
Description: erythrina crystagalli lectin
Class: lectin
Keywords: lectin, carbohydrate binding
Deposited on 2004-03-19, released 2004-06-22
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin (ecl)
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uzya_
  • Chain 'B':
    Compound: lectin (ecl)
    Species: Erythrina crista-galli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uzyb_
  • Heterogens: CA, MN, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzyA (A:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzyA (A:)
    etisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiwd
    mttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdnsy
    qtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilla
    vlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uzyB (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzyB (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpe