PDB entry 1uzy

View 1uzy on RCSB PDB site
Description: erythrina crystagalli lectin
Deposited on 2004-03-19, released 2004-06-22
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-19, with a file datestamp of 2004-08-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uzya_
  • Chain 'B':
    Domains in SCOP 1.71: d1uzyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzyA (A:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzyA (A:)
    etisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiwd
    mttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdnsy
    qtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilla
    vlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uzyB (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzyB (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpe