PDB entry 1uzy

View 1uzy on RCSB PDB site
Description: Erythrina crystagalli lectin
Class: lectin
Keywords: lectin, carbohydrate binding
Deposited on 2004-03-19, released 2004-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: ERYTHRINA CRISTA-GALLI [TaxId:49817]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uzya_
  • Chain 'B':
    Compound: lectin
    Species: ERYTHRINA CRISTA-GALLI [TaxId:49817]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uzyb_
  • Heterogens: EPE, CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzyA (A:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzyA (A:)
    etisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiwd
    mttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdnsy
    qtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilla
    vlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uzyB (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpet
    nd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzyB (B:)
    vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
    yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpe