PDB entry 1uzw

View 1uzw on RCSB PDB site
Description: isopenicillin n synthase with l-d-(a-aminoadipoyl)-l-cysteinyl-d-isodehydrovaline
Deposited on 2004-03-17, released 2004-06-10
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-10, with a file datestamp of 2004-06-10.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.17348
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1uzwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzwA (A:)
    mgsvskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktke
    fhmsitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqak
    tpthevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddt
    lasvvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyq
    dieaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdpr
    epngksdreplsygdylqnglvslinkngqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzwA (A:)
    svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
    msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
    thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
    svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
    eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
    ngksdreplsygdylqnglvslinkngqt