PDB entry 1uzv

View 1uzv on RCSB PDB site
Description: high affinity fucose binding of pseudomonas aeruginosa lectin ii: 1.0 a crystal structure of the complex
Deposited on 2004-03-17, released 2004-12-08
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-08, with a file datestamp of 2004-12-08.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.1146
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uzva_
  • Chain 'B':
    Domains in SCOP 1.71: d1uzvb_
  • Chain 'C':
    Domains in SCOP 1.71: d1uzvc_
  • Chain 'D':
    Domains in SCOP 1.71: d1uzvd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzvA (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzvB (B:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzvC (C:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzvD (D:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg