PDB entry 1uzu

View 1uzu on RCSB PDB site
Description: Glycogen Phosphorylase b in complex with indirubin-5'-sulphonate
Class: transferase
Keywords: transferase, glycosyltransferase, glycogen metabolism, carbohydrate metabolism, pyridoxal phosphate
Deposited on 2004-03-16, released 2004-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uzua_
  • Heterogens: PLP, INR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzuA (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzuA (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    fgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksstnfda
    fpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealerwp
    vhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciag
    shavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerig
    eeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvk
    riheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigd
    vvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngalt
    igtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssg
    ffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniats
    gkfssdrtiaqyareiwgvepsrqrlpapd