PDB entry 1uzn

View 1uzn on RCSB PDB site
Description: maba from mycobacterium tuberculosis
Class: oxidoreductase
Keywords: beta-ketoacyl reductase, oxidoreductase
Deposited on 2004-03-14, released 2005-03-23
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.18713
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: MYCOBACTERIUM TUBERCULOSIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48930 (Start-246)
      • engineered mutation (59)
      • engineered mutation (143)
    Domains in SCOP 1.73: d1uzna1
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: MYCOBACTERIUM TUBERCULOSIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48930 (Start-246)
      • engineered mutation (59)
      • engineered mutation (143)
    Domains in SCOP 1.73: d1uznb1
  • Heterogens: CS, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uznA (A:)
    mtatategakppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvev
    dvtdsdavdraftaveehqgpvevlvsnaglsadaflmrmteekfekvinanltgafrva
    qrasrsmqrnkfgrmifigsvsglwgignqanyaaskagvigmarsiarelskanvtanv
    vapgyidtdmtralderiqqgalqfipakrvgtpaevagvvsflasedasyisgavipvd
    ggmgmgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uznA (A:)
    akppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvevdvtdsdav
    draftaveehqgpvevlvsnaglsadaflmrmteekfekvinanltgafrvaqrasrsmq
    rnkfgrmifigsvsglwgignqanyaaskagvigmarsiarelskanvtanvvapgyidt
    dmtralderiqqgalqfipakrvgtpaevagvvsflasedasyisgavipvdggmgmgh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uznB (B:)
    mtatategakppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvev
    dvtdsdavdraftaveehqgpvevlvsnaglsadaflmrmteekfekvinanltgafrva
    qrasrsmqrnkfgrmifigsvsglwgignqanyaaskagvigmarsiarelskanvtanv
    vapgyidtdmtralderiqqgalqfipakrvgtpaevagvvsflasedasyisgavipvd
    ggmgmgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uznB (B:)
    akppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvevdvtdsdav
    draftaveehqgpvevlvsnaglsadaflmrmteekfekvinanltgafrvaqrasrsmq
    rnkfgrmifigsvsglwgignqanyaaskagvigmarsiarelskanvtanvvapgyidt
    alqfipakrvgtpaevagvvsflasedasyisgavipvdggmgmgh