PDB entry 1uzm

View 1uzm on RCSB PDB site
Description: maba from mycobacterium tuberculosis
Class: oxidoreductase
Keywords: beta-ketoacyl reductase, oxidoreductase
Deposited on 2004-03-14, released 2005-03-23
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.19922
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: MYCOBACTERIUM TUBERCULOSIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48930
      • engineered mutation (59)
    Domains in SCOP 1.73: d1uzma1
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: MYCOBACTERIUM TUBERCULOSIS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48930
      • engineered mutation (59)
    Domains in SCOP 1.73: d1uzmb1
  • Heterogens: CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzmA (A:)
    mtatategakppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvev
    dvtdsdavdraftaveehqgpvevlvsnaglsadaflmrmteekfekvinanltgafrva
    qrasrsmqrnkfgrmifigsvsglwgignqanyaaskagvigmarsiarelskanvtanv
    vapgyidtdmtralderiqqgalqfipakrvgtpaevagvvsflasedasyisgavipvd
    ggmgmgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzmA (A:)
    akppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvevdvtdsdav
    draftaveehqgpvevlvsnaglsarmteekfekvinanltgafrvaqrasrsmqrnkfg
    rmifigsvsgnqanyaaskagvigmarsiarelskanvtanvvapgyidtdmtralderi
    qqgalqfipakrvgtpaevagvvsflasedasyisgavipvdggmgm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uzmB (B:)
    mtatategakppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvev
    dvtdsdavdraftaveehqgpvevlvsnaglsadaflmrmteekfekvinanltgafrva
    qrasrsmqrnkfgrmifigsvsglwgignqanyaaskagvigmarsiarelskanvtanv
    vapgyidtdmtralderiqqgalqfipakrvgtpaevagvvsflasedasyisgavipvd
    ggmgmgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzmB (B:)
    akppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvevdvtdsdav
    draftaveehqgpvevlvsnaglsamteekfekvinanltgafrvaqrasrsmqrnkfgr
    mifigsvsqanyaaskagvigmarsiarelskanvtanvvapgyidtalqfipakrvgtp
    aevagvvsflasedasyisgavipvdggmgm