PDB entry 1uzl

View 1uzl on RCSB PDB site
Description: maba from mycobacterium tuberculosis
Class: oxidoreductase
Keywords: oxidoreductase, beta-ketoacyl reductase, fatty acid biosynthesis, nadp,
Deposited on 2004-03-14, released 2005-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1873
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzla1
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzlb_
  • Heterogens: CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzlA (A:)
    mtatategakppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvec
    dvtdsdavdraftaveehqgpvevlvsnaglsadaflmrmteekfekvinanltgafrva
    qrasrsmqrnkfgrmifigsvsgswgignqanyaaskagvigmarsiarelskanvtanv
    vapgyidtdmtralderiqqgalqfipakrvgtpaevagvvsflasedasyisgavipvd
    ggmgmgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzlA (A:)
    akppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvecdvtdsdav
    draftaveehqgpvevlvsnaglsadmteekfekvinanltgafrvaqrasrsmqrnkfg
    rmifigsvsgswgqanyaaskagvigmarsiarelskanvtanvvapgyidtdmtralde
    riqqgalqfipakrvgtpaevagvvsflasedasyisgavipvdggmgmgh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uzlB (B:)
    mtatategakppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvec
    dvtdsdavdraftaveehqgpvevlvsnaglsadaflmrmteekfekvinanltgafrva
    qrasrsmqrnkfgrmifigsvsgswgignqanyaaskagvigmarsiarelskanvtanv
    vapgyidtdmtralderiqqgalqfipakrvgtpaevagvvsflasedasyisgavipvd
    ggmgmgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzlB (B:)
    akppfvsrsvlvtggnrgiglaiaqrlaadghkvavthrgsgapkglfgvecdvtdsdav
    draftaveehqgpvevlvsnaglsadaflmrmteekfekvinanltgafrvaqrasrsmq
    rnkfgrmifigsvsgswgignqanyaaskagvigmarsiarelskanvtanvvapgyidt
    alqfipakrvgtpaevagvvsflasedasyisgavipvdggmgmgh