PDB entry 1uzi

View 1uzi on RCSB PDB site
Description: c3 exoenzyme from clostridium botulinum, tetragonal form
Class: transferase
Keywords: transferase, c3, ADP-ribosyltransferase
Deposited on 2004-03-12, released 2004-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: CLOSTRIDIUM BOTULINUM [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzia_
  • Chain 'B':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: CLOSTRIDIUM BOTULINUM [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzib_
  • Heterogens: V4O, VO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uziA (A:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uziB (B:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk