PDB entry 1uzg

View 1uzg on RCSB PDB site
Description: crystal structure of the dengue type 3 virus envelope protein
Deposited on 2004-03-11, released 2005-03-15
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.286
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major envelope protein E
    Species: DENGUE VIRUS TYPE 3 [TaxId:11069]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27915 (0-391)
      • conflict (128)
      • conflict (200)
  • Chain 'B':
    Compound: major envelope protein E
    Species: DENGUE VIRUS TYPE 3 [TaxId:11069]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27915 (0-391)
      • conflict (128)
      • conflict (200)
  • Heterogens: NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1uzgA (A:)
    mrcvgvgnrdfveglsgatwvdvvlehggcvttmaknkptldielqkteatqlatlrklc
    iegkitnittdsrcptqgeailpeeqdqnyvckhtyvdrgwgngcglfgkgslvtcakfq
    clesiegkivqhenlkytviitvhtgdqhqvgnetqgvtaeitsqastaeailpeygtlg
    lecsprtgldfnemilltmkdkawmvhrqwffdlplpwtsgattktptwnrkellvtfkn
    ahakkqevvvlgsqegamhtaltgateiqtsggtsifaghlkcrlkmdklklkgmsyamc
    lntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanpvvtkke
    epvnieaeppfgesnivigigdkalkinwyrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1uzgB (B:)
    mrcvgvgnrdfveglsgatwvdvvlehggcvttmaknkptldielqkteatqlatlrklc
    iegkitnittdsrcptqgeailpeeqdqnyvckhtyvdrgwgngcglfgkgslvtcakfq
    clesiegkivqhenlkytviitvhtgdqhqvgnetqgvtaeitsqastaeailpeygtlg
    lecsprtgldfnemilltmkdkawmvhrqwffdlplpwtsgattktptwnrkellvtfkn
    ahakkqevvvlgsqegamhtaltgateiqtsggtsifaghlkcrlkmdklklkgmsyamc
    lntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanpvvtkke
    epvnieaeppfgesnivigigdkalkinwyrk