PDB entry 1uze

View 1uze on RCSB PDB site
Description: complex of the anti-hypertensive drug enalaprilat and the human testicular angiotensin I-converting enzyme
Class: metalloprotease
Keywords: angiotensin converting enzyme, inhibitor, enalaprilat, zinc dependant peptidase, anti-hypertensive drug, metalloprotease
Deposited on 2004-03-11, released 2004-07-16
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin converting enzyme
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uzea_
  • Heterogens: ZN, CL, GLY, EAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzeA (A:)
    lvtdeaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkyg
    tqarkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpng
    sclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvda
    gdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllg
    nmwaqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefw
    nksmlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykd
    lpvalreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkia
    fipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhips
    svpyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpe
    amqlitgqpnmsasamlsyfkplldwlrtenelhgeklgwpqynwtpns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzeA (A:)
    deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa
    rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl
    qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds
    wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw
    aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnks
    mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv
    alreganpgfheaigdvlalsvstpkhlhslnllssdehdinflmkmaldkiafipfsyl
    vdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvpyiry
    fvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamqlitg
    qpnmsasamlsyfkplldwlrtenelhgeklgwpq