PDB entry 1uzd

View 1uzd on RCSB PDB site
Description: chlamydomonas,spinach chimeric rubisco
Class: lyase
Keywords: lyase, rubisco, photosynthesis, carbon dioxide fixation, photorespiration, oxidoreductase, monooxygenase, chloroplast, transit peptide, multigene family
Deposited on 2004-03-11, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: -1.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOPe 2.07: d1uzda1, d1uzda2
  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOPe 2.07: d1uzdb1, d1uzdb2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase small chain 1, ribulose bisphosphate carboxylase small chain 2
    Species: CHLAMYDOMONAS REINHARDTII, SPINACIA OLERACEA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzdc1
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOPe 2.07: d1uzde1, d1uzde2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase small chain 1, ribulose bisphosphate carboxylase small chain 2
    Species: CHLAMYDOMONAS REINHARDTII, SPINACIA OLERACEA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzdf_
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOPe 2.07: d1uzdh1, d1uzdh2
  • Chain 'I':
    Compound: ribulose bisphosphate carboxylase small chain 1, ribulose bisphosphate carboxylase small chain 2
    Species: CHLAMYDOMONAS REINHARDTII, SPINACIA OLERACEA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzdi_
  • Chain 'J':
    Compound: ribulose bisphosphate carboxylase small chain 1, ribulose bisphosphate carboxylase small chain 2
    Species: CHLAMYDOMONAS REINHARDTII, SPINACIA OLERACEA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzdj_
  • Chain 'K':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOPe 2.07: d1uzdk1, d1uzdk2
  • Chain 'M':
    Compound: ribulose bisphosphate carboxylase small chain 1, ribulose bisphosphate carboxylase small chain 2
    Species: CHLAMYDOMONAS REINHARDTII, SPINACIA OLERACEA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzdm_
  • Chain 'O':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOPe 2.07: d1uzdo1, d1uzdo2
  • Chain 'P':
    Compound: ribulose bisphosphate carboxylase small chain 1, ribulose bisphosphate carboxylase small chain 2
    Species: CHLAMYDOMONAS REINHARDTII, SPINACIA OLERACEA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzdp_
  • Chain 'R':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOPe 2.07: d1uzdr1, d1uzdr2
  • Chain 'T':
    Compound: ribulose bisphosphate carboxylase small chain 1, ribulose bisphosphate carboxylase small chain 2
    Species: CHLAMYDOMONAS REINHARDTII, SPINACIA OLERACEA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzdt_
  • Chain 'V':
    Compound: ribulose bisphosphate carboxylase large chain
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • conflict (45)
    Domains in SCOPe 2.07: d1uzdv1, d1uzdv2
  • Chain 'W':
    Compound: ribulose bisphosphate carboxylase small chain 1, ribulose bisphosphate carboxylase small chain 2
    Species: CHLAMYDOMONAS REINHARDTII, SPINACIA OLERACEA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzdw_
  • Heterogens: MG, CAP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzdA (A:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdA (A:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uzdB (B:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdB (B:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uzdC (C:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    ktardfqpankrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdC (C:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    kqpankrsv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uzdE (E:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdE (E:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uzdF (F:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    ktardfqpankrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdF (F:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    kqpankrsv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1uzdH (H:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdH (H:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1uzdI (I:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    ktardfqpankrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdI (I:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    kqpankrsv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1uzdJ (J:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    ktardfqpankrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdJ (J:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    kqpankrsv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1uzdK (K:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdK (K:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1uzdM (M:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    ktardfqpankrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdM (M:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    kqpankrsv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1uzdO (O:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdO (O:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1uzdP (P:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    ktardfqpankrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdP (P:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    kqpankrsv
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1uzdR (R:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdR (R:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1uzdT (T:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    ktardfqpankrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdT (T:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    kqpankrsv
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1uzdV (V:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdV (V:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1uzdW (W:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    ktardfqpankrsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzdW (W:)
    mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefatdhgfvyrehhnspg
    yydgrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgflvqrp
    kqpankrsv