PDB entry 1uzc

View 1uzc on RCSB PDB site
Description: the structure of an ff domain from human hypa/fbp11
Class: nuclear protein
Keywords: nuclear protein, nmr structure, transcription, phosphopeptide recognition, RNA polymerase II carboxyl-terminal domain
Deposited on 2004-03-09, released 2004-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein flj21157
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZC
    • Uniprot Q9H782 (Start-70)
    Domains in SCOPe 2.07: d1uzca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzcA (A:)
    gsqpakktytwntkeeakqafkellkekrvpsnasweqamkmiindprysalaklsekkq
    afnaykvqtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzcA (A:)
    qpakktytwntkeeakqafkellkekrvpsnasweqamkmiindprysalaklsekkqaf
    naykvqtek