PDB entry 1uzc

View 1uzc on RCSB PDB site
Description: the structure of an ff domain from human hypa/fbp11
Class: nuclear protein
Keywords: nuclear protein, transcription, phosphopeptide recognition, RNA polymerase II carboxyl-terminal domain
Deposited on 2004-03-09, released 2004-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein flj21157
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 1UZC
  • Uniprot Q9H782 (Start-70)
  Domains in SCOPe 2.08: d1uzca_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1uzcA (A:)
  gsqpakktytwntkeeakqafkellkekrvpsnasweqamkmiindprysalaklsekkq
  afnaykvqtek
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1uzcA (A:)
  qpakktytwntkeeakqafkellkekrvpsnasweqamkmiindprysalaklsekkqaf
  naykvqtek