PDB entry 1uzb

View 1uzb on RCSB PDB site
Description: 1-pyrroline-5-carboxylate dehydrogenase
Deposited on 2004-03-09, released 2004-03-11
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-11, with a file datestamp of 2004-03-11.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.177
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1uzba_
  • Chain 'B':
    Domains in SCOP 1.67: d1uzbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzbA (A:)
    mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa
    psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl
    vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi
    apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg
    eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggknaiivdet
    adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl
    gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg
    pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv
    gvqpfggfklsgtnaktgaldylrlflemkavaerf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzbB (B:)
    mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa
    psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl
    vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi
    apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg
    eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggknaiivdet
    adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl
    gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg
    pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv
    gvqpfggfklsgtnaktgaldylrlflemkavaerf