PDB entry 1uzb

View 1uzb on RCSB PDB site
Description: 1-pyrroline-5-carboxylate dehydrogenase
Class: oxidoreductase
Keywords: dehydrogenase, 1-pyrroline-5-carboxylate, oxidoreductase, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2004-03-09, released 2004-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.177
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzba_
  • Chain 'B':
    Compound: 1-pyrroline-5-carboxylate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uzbb_
  • Heterogens: MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzbA (A:)
    mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa
    psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl
    vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi
    apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg
    eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggknaiivdet
    adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl
    gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg
    pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv
    gvqpfggfklsgtnaktgaldylrlflemkavaerf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uzbB (B:)
    mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsa
    psevvgttakagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatl
    vyevgknwveasadvaeaidfieyyaraalryrypavevvpypgednesfyvplgagvvi
    apwnfpvaiftgmivgpvavgntviakpaedavvvgakvfeifheagfppgvvnflpgvg
    eevgaylvehprirfinftgslevglkiyeaagrlapgqtwfkrayvetggknaiivdet
    adfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkraerlsvgpaeenpdl
    gpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkariaqeeifg
    pvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalv
    gvqpfggfklsgtnaktgaldylrlflemkavaerf