PDB entry 1uza

View 1uza on RCSB PDB site
Description: Crystallographic structure of a feruloyl esterase from Aspergillus niger
Class: hydrolase
Keywords: hydrolase, serine esterase, xylan degradation
Deposited on 2004-03-08, released 2004-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.158
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: feruloyl esterase a
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42807 (Start-259)
      • conflict (202-203)
      • expression tag (260)
    Domains in SCOPe 2.06: d1uzaa1, d1uzaa2
  • Chain 'B':
    Compound: feruloyl esterase a
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42807 (Start-259)
      • conflict (202-203)
      • expression tag (260)
    Domains in SCOPe 2.06: d1uzab1, d1uzab2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzaA (A:)
    astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
    iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
    qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
    pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
    qgvndahttyfgmtsgactwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzaA (A:)
    stqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtskei
    itvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqasq
    ypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvssp
    ettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqggq
    gvndahttyfgmtsgactwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uzaB (B:)
    astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
    iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
    qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
    pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
    qgvndahttyfgmtsgactwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzaB (B:)
    stqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtskei
    itvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqasq
    ypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvssp
    ettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqggq
    gvndahttyfgmtsgactwv