PDB entry 1uza

View 1uza on RCSB PDB site
Description: crystallographic structure of a feruloyl esterase from aspergillus niger
Deposited on 2004-03-08, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.158
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uzaa_
  • Chain 'B':
    Domains in SCOP 1.71: d1uzab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uzaA (A:)
    astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
    iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
    qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
    pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
    qgvndahttyfgmtsgactwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzaA (A:)
    stqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtskei
    itvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqasq
    ypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvssp
    ettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqggq
    gvndahttyfgmtsgactwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uzaB (B:)
    astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
    iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
    qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
    pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
    qgvndahttyfgmtsgactwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uzaB (B:)
    stqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtskei
    itvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqasq
    ypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvssp
    ettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqggq
    gvndahttyfgmtsgactwv