PDB entry 1uz8

View 1uz8 on RCSB PDB site
Description: anti-lewis x fab fragment in complex with lewis x
Class: antibody/complex
Keywords: antibody, anti-carbohydrate
Deposited on 2004-03-05, released 2004-06-29
The last revision prior to the SCOP 1.75 freeze date was dated 2004-07-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: -1.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg fab (igg3,kappa) light chain 291-2g3-a
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZ8 (0-End)
    Domains in SCOP 1.75: d1uz8a1, d1uz8a2
  • Chain 'B':
    Compound: igg fab (igg3,kappa) heavy chain 291-2g3-a
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1uz8b1, d1uz8b2
  • Chain 'H':
    Compound: igg fab (igg3,kappa) heavy chain 291-2g3-a
    Species: MUS MUSCULUS
    Domains in SCOP 1.75: d1uz8h1, d1uz8h2
  • Chain 'L':
    Compound: igg fab (igg3,kappa) light chain 291-2g3-a
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZ8 (0-End)
    Domains in SCOP 1.75: d1uz8l1, d1uz8l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uz8A (A:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uz8B (B:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpggssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfyslsslv
    tvpsstwpsqtvicnvahpasktelikriepr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uz8H (H:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpggssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfyslsslv
    tvpsstwpsqtvicnvahpasktelikriepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uz8L (L:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne