PDB entry 1uz6

View 1uz6 on RCSB PDB site
Description: anti-lewis x fab fragment uncomplexed
Class: immune system
Keywords: immune system, antibody-complex, antibody, anti-carbohydrate
Deposited on 2004-03-05, released 2004-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.198
AEROSPACI score: -1.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: igg fab (igg3, kappa) light chain 291-2g3-a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZ6 (0-End)
    Domains in SCOPe 2.06: d1uz6e1, d1uz6e2
  • Chain 'F':
    Compound: igg fab (igg3, kappa) heavy chain 291-2g3-a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZ6 (0-216)
    Domains in SCOPe 2.06: d1uz6f1, d1uz6f2
  • Chain 'H':
    Compound: igg fab (igg3, kappa) heavy chain 291-2g3-a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZ6 (0-216)
    Domains in SCOPe 2.06: d1uz6h1, d1uz6h2
  • Chain 'L':
    Compound: igg fab (igg3, kappa) light chain 291-2g3-a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZ6 (0-End)
    Domains in SCOPe 2.06: d1uz6l1, d1uz6l2
  • Chain 'M':
    Compound: igg fab (igg3, kappa) light chain 291-2g3-a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZ6 (0-217)
    Domains in SCOPe 2.06: d1uz6m1, d1uz6m2
  • Chain 'P':
    Compound: igg fab (igg3, kappa) heavy chain 291-2g3-a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZ6 (0-216)
    Domains in SCOPe 2.06: d1uz6p1, d1uz6p2
  • Chain 'V':
    Compound: igg fab (igg3, kappa) light chain 291-2g3-a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZ6 (0-217)
    Domains in SCOPe 2.06: d1uz6v1, d1uz6v2
  • Chain 'W':
    Compound: igg fab (igg3, kappa) heavy chain 291-2g3-a
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZ6 (0-216)
    Domains in SCOPe 2.06: d1uz6w1, d1uz6w2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uz6E (E:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6E (E:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceatpivksfnrn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uz6F (F:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfys
    lsslvtvpsstwpsqtvicnvahpasktelikriepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6F (F:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpsvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfyslsslvtvp
    sstwpsqtvicnvahpasktelikriepr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1uz6H (H:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfys
    lsslvtvpsstwpsqtvicnvahpasktelikriepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6H (H:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfyslsslvt
    vpsstwpsqtvicnvahpasktelikriepr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1uz6L (L:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6L (L:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceatpivksfnrn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1uz6M (M:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6M (M:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceatpivksfnrnr
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1uz6P (P:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfys
    lsslvtvpsstwpsqtvicnvahpasktelikriepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6P (P:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfyslsslv
    tvpsstwpsqtvicnvahpasktelikriepr
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1uz6V (V:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6V (V:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceatpivksfnrnr
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1uz6W (W:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfys
    lsslvtvpsstwpsqtvicnvahpasktelikriepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6W (W:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfyslsslv
    tvpsstwpsqtvicnvahpasktelikriepr