PDB entry 1uz6

View 1uz6 on RCSB PDB site
Description: anti-lewis x fab fragment uncomplexed
Deposited on 2004-03-05, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-26, with a file datestamp of 2004-07-26.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.1976
AEROSPACI score: -1.59 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uz6E (E:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6E (E:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceatpivksfnrn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uz6F (F:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfys
    lsslvtvpsstwpsqtvicnvahpasktelikriepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6F (F:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpsvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfyslsslvtvp
    sstwpsqtvicnvahpasktelikriepr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1uz6H (H:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfys
    lsslvtvpsstwpsqtvicnvahpasktelikriepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6H (H:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfyslsslvt
    vpsstwpsqtvicnvahpasktelikriepr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1uz6L (L:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6L (L:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceatpivksfnrn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1uz6M (M:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6M (M:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceatpivksfnrnr
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1uz6P (P:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfys
    lsslvtvpsstwpsqtvicnvahpasktelikriepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6P (P:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfyslsslv
    tvpsstwpsqtvicnvahpasktelikriepr
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1uz6V (V:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6V (V:)
    divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
    sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceatpivksfnrnr
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1uz6W (W:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfys
    lsslvtvpsstwpsqtvicnvahpasktelikriepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz6W (W:)
    evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
    tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvssatt
    tapsvyplvpsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfyslsslv
    tvpsstwpsqtvicnvahpasktelikriepr