PDB entry 1uz5

View 1uz5 on RCSB PDB site
Description: the crystal structure of molybdopterin biosynthesis moea protein from pyrococcus horikosii
Deposited on 2004-03-05, released 2004-03-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-10, with a file datestamp of 2004-03-10.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.218
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uz5A (A:)
    maflkvvplekalevvqsfkispgieevpiekglgriaaediyspidvppfdratvdgya
    vraedtfmaseaspvrlkvigsvhageepkfklgkgeaayistgamlpgnadaviqfedv
    ervngeiliykpaypglgvmkkgidiekgrllvkkgerlgfkqtallsavginkvkvfrk
    pkvavistgneivppgnelkpgqiydingralcdainelggegifmgvarddkeslkali
    ekavnvgdvvvisggasggtkdltasvieelgevkvhgiaiqpgkptiigvikgkpvfgl
    pgyptscltnftllvvplllralgregkigkkvarlkhkvfsvkgrrqflpvklegdlav
    pilkgsgavtsfidadgfveipetvesldegeevevtlfkgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz5A (A:)
    kvvplekalevvqsfkispgieevpiekglgriaaediyspidvppfdratvdgyavrae
    dtfmaseaspvrlkvigsvhageepkfklgkgeaayistgamlpgnadaviqfedvervn
    geiliykpaypglgvmkkgidiekgrllvkkgerlgfkqtallsavginkvkvfrkpkva
    vistgneivppgnelkpgqiydingralcdainelggegifmgvarddkeslkaliekav
    nvgdvvvisggadltasvieelgevkvhgiaiqpgkptiigvikgkpvfglpgyptsclt
    nftllvvplllralgregkigkkvarlkhkvfsvrrqflpvklegdlavpilkgsgavts
    fidadgfveipetvesldegeevevtlfkgw