PDB entry 1uz4

View 1uz4 on RCSB PDB site
Description: common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis
Class: hydrolase
Keywords: mannosidase, inhibitor, isofagomaninelactam, hydrolase
Deposited on 2004-03-04, released 2004-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.135
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: man5a
    Species: CELLVIBRIO MIXTUS [TaxId:39650]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uz4a_
  • Heterogens: IFL, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uz4A (A:)
    mvaesnsavaptanvatspahehfvrvngghfelqgkpyvitgvnmwyaaylgapnevgd
    rdrlakeldnlkaigvnnlrvlavsekseinsavkpavtngfgnydetllqgldyllvel
    akrdmtvvlyfnnfwqwsggmtqymawiegepvqdpnvtneweafmaksasfyrsekaqq
    eyrktlekiitrvnsingkayvddatimswqlaneprpgnsqttaeekqiyidwvhaaaa
    yiktldahhlvssgsegemgsvndmqvfidahatpdidyltyhmwirnwswfdktkpaet
    wpsawekaqnymrahidvakqlnkplvleefgldrdmgsyamdstteyrdnyfrgvfelm
    lasleqgepsagyniwawngygrttranywwqegddfmgdppqeeqgmygvfdtdtstia
    imkefnarfqpklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz4A (A:)
    ehfvrvngghfelqgkpyvitgvnmwyaaylgapnevgdrdrlakeldnlkaigvnnlrv
    lavsekseinsavkpavtngfgnydetllqgldyllvelakrdmtvvlyfnnfwqwsggm
    tqymawiegepvqdpnvtneweafmaksasfyrsekaqqeyrktlekiitrvnsingkay
    vddatimswqlaneprpgnsqttaeekqiyidwvhaaaayiktldahhlvssgsegemgs
    vndmqvfidahatpdidyltyhmwirnwswfdktkpaetwpsawekaqnymrahidvakq
    lnkplvleefgldrdmgsyamdstteyrdnyfrgvfelmlasleqgepsagyniwawngy
    grttranywwqegddfmgdppqeeqgmygvfdtdtstiaimkefnarfqp