PDB entry 1uz3

View 1uz3 on RCSB PDB site
Description: crystal structure of novel protein emsy
Class: chromatin regulator
Keywords: chromatin regulator, chromatin regulators, royal family domain
Deposited on 2004-03-03, released 2005-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.1449
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: emsy protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UZ3 (0-1)
    • Uniprot Q8TE50 (2-101)
    Domains in SCOPe 2.07: d1uz3a_
  • Chain 'B':
    Compound: emsy protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uz3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uz3A (A:)
    gsmpvvwptlldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsi
    sterhraevrravnderlttiahnmsgpnsssewsiegrrlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uz3B (B:)
    gsmpvvwptlldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsi
    sterhraevrravnderlttiahnmsgpnsssewsiegrrlv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz3B (B:)
    pvvwptlldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsiste
    rhraevrravnderlttiahnmsgpnsssewsiegrr