PDB entry 1uz2

View 1uz2 on RCSB PDB site
Description: the cys121ser mutant of beta-lactoglobulin
Deposited on 2004-03-03, released 2004-05-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-20, with a file datestamp of 2004-05-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.2135
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Domains in SCOP 1.69: d1uz2x_

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1uz2X (X:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    slvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz2X (X:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    slvrtpevddealekfdkalkalpmhirlsfnptqlee