PDB entry 1uz2

View 1uz2 on RCSB PDB site
Description: The Cys121Ser Mutant of Beta-Lactoglobulin
Class: transport protein
Keywords: lipocalin, beta-barrel, transport protein, milk, whey retinol-binding, allergen
Deposited on 2004-03-03, released 2004-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02754 (0-End)
      • see remark 999 (63)
      • see remark 999 (117)
      • engineered mutation (120)
    Domains in SCOPe 2.08: d1uz2x_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1uz2X (X:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    slvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz2X (X:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    slvrtpevddealekfdkalkalpmhirlsfnptqlee