PDB entry 1uz1

View 1uz1 on RCSB PDB site
Description: family 1 b-glucosidase from thermotoga maritima in complex with isofagomine lactam
Class: hydrolase
Keywords: hydrolase, glucoside hydrolysis, family gh1, enzyme, isofagomine lactam
Deposited on 2004-03-03, released 2004-11-23
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19659
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase a
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uz1a_
  • Chain 'B':
    Compound: beta-glucosidase a
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uz1b_
  • Heterogens: IFL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uz1A (A:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz1A (A:)
    vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
    edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
    dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
    gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekediravrfmh
    qfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkfd
    pakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsedgrv
    hdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdystqkr
    ivkdsgywysnvvknngle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uz1B (B:)
    mgsshhhhhhssglvprgshmasnvkkfpegflwgvatasyqiegspladgagmsiwhtf
    shtpgnvkngdtgdvacdhynrwkedieiieklgvkayrfsiswprilpegtgrvnqkgl
    dfynriidtllekgitpfvtiyhwdlpfalqlkggwanreiadwfaeysrvlfenfgdrv
    knwitlnepwvvaivghlygvhapgmrdiyvafravhnllraharavkvfretvkdgkig
    ivfnngyfepasekeediravrfmhqfnnyplflnpiyrgdypelvlefareylpenykd
    dmseiqekidfvglnyysghlvkfdpdapakvsfverdlpktamgweivpegiywilkkv
    keeynppevyitengaafddvvsedgrvhdqnridylkahigqawkaiqegvplkgyfvw
    slldnfewaegyskrfgivyvdystqkrivkdsgywysnvvknngled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uz1B (B:)
    nvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrw
    kedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyh
    wdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvha
    pgmrdiyvafravhnllraharavkvfretvdgkigivfnngyfepasekeediravrfm
    hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
    dpdakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsedg
    rvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdystq
    krivkdsgywysnvvknngl