PDB entry 1uz0

View 1uz0 on RCSB PDB site
Description: carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with glc-4glc-3glc-4glc
Deposited on 2004-03-03, released 2004-03-11
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-11, with a file datestamp of 2004-03-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.15231
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1uz0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uz0A (A:)
  mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
  vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
  nlnwirinkth