PDB entry 1uyz

View 1uyz on RCSB PDB site
Description: carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with xylotetraose
Class: carbohydrate binding module
Keywords: carbohydrate binding module, cbm6, mixed beta1, 3-1, 4 linked glucan, xylotetraose
Deposited on 2004-03-03, released 2004-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.162
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase b
    Species: CELLVIBRIO MIXTUS [TaxId:39650]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UYZ (0-0)
    • Uniprot O07653 (1-130)
    Domains in SCOPe 2.07: d1uyza_
  • Chain 'B':
    Compound: cellulase b
    Species: CELLVIBRIO MIXTUS [TaxId:39650]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UYZ (0-0)
    • Uniprot O07653 (1-130)
    Domains in SCOPe 2.07: d1uyzb_
  • Heterogens: CA, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uyzA (A:)
mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
nlnwirinkth

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uyzB (B:)
mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
nlnwirinkth