PDB entry 1uyx

View 1uyx on RCSB PDB site
Description: carbohydrate binding module (cbm6cm-2) from cellvibrio mixtus lichenase 5a in complex with cellobiose
Class: carbohydrate binding module
Keywords: carbohydrate binding module, cbm6, mixted beta1, 3-1, 4 linked glucan, cellobiose
Deposited on 2004-03-03, released 2004-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.181
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase b
    Species: CELLVIBRIO MIXTUS [TaxId:39650]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UYX (0-0)
    • Uniprot O07653 (1-End)
    Domains in SCOPe 2.07: d1uyxa_
  • Chain 'B':
    Compound: cellulase b
    Species: CELLVIBRIO MIXTUS [TaxId:39650]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UYX (0-0)
    • Uniprot O07653 (1-End)
    Domains in SCOPe 2.07: d1uyxb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uyxA (A:)
    mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
    vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
    nlnwirinkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uyxA (A:)
    mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
    vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
    nlnwirinkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uyxB (B:)
    mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
    vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
    nlnwirinkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uyxB (B:)
    mviatiqaedhsqqsgtqqetttdtgggknvgyidagdwlsyagtpvnipssgsylieyr
    vasqngggsltfeeaggapvhgtiaipatggwqtwttiqhtvnlsagshqfgikanaggw
    nlnwirinkt