PDB entry 1uyv

View 1uyv on RCSB PDB site
Description: Acetyl-CoA carboxylase carboxyltransferase domain L1705I/V1967I mutant
Class: transferase
Keywords: transferase, carboxylase, carboxyltransferase, mutant
Deposited on 2004-03-02, released 2004-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.212
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00955 (0-End)
      • engineered mutation (223)
      • engineered mutation (485)
    Domains in SCOPe 2.07: d1uyva1, d1uyva2
  • Chain 'B':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00955 (0-End)
      • engineered mutation (223)
      • engineered mutation (485)
    Domains in SCOPe 2.07: d1uyvb1, d1uyvb2
  • Chain 'C':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00955
      • engineered mutation (223)
      • engineered mutation (485)
    Domains in SCOPe 2.07: d1uyvc1, d1uyvc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uyvA (A:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgvecirgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfneilkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrere
    llpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlsh
    qvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakk
    irsdhdnaidglsevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uyvA (A:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmacirgsgliagatsrayhdiftitlvtcrs
    vgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshlt
    avddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegret
    esgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanpns
    aetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfneilkygs
    fivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlerssrmv
    akgviskelewtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvd
    heddrqvatwieenyktlddklkglklesfaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uyvB (B:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgvecirgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfneilkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrere
    llpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlsh
    qvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakk
    irsdhdnaidglsevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uyvB (B:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigecirgsgliagatsrayhdiftitlvtcrsv
    gigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshlta
    vddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegrete
    sgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanpnsa
    etliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfneilkygsf
    ivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragviskelewte
    arrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwiee
    nyktlddklkglk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uyvC (C:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgvecirgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfneilkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrere
    llpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlsh
    qvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakk
    irsdhdnaidglsevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uyvC (C:)
    wlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelt
    everepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteya
    rkrgipriylaansgarigmgvecirgsgliagatsrayhdiftitlvtcrsvgigaylv
    rlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshltavddlagv
    ekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeygl
    fdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqep
    gqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfneilkygsfivdalvd
    ykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepdrssrmvakgvis
    kelewtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrq
    vatwieenyktlddklkglklesfaqdlakk