PDB entry 1uyt

View 1uyt on RCSB PDB site
Description: Acetyl-CoA carboxylase carboxyltransferase domain
Deposited on 2004-03-02, released 2004-03-29
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-29, with a file datestamp of 2004-03-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uytA (A:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrere
    llpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlsh
    qvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakk
    irsdhdnaidglsevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uytA (A:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskele
    wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
    ieenyktlddklkglklesfaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uytB (B:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrere
    llpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlsh
    qvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakk
    irsdhdnaidglsevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uytB (B:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskele
    wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
    ieenyktlddklkglk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uytC (C:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrere
    llpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlsh
    qvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakk
    irsdhdnaidglsevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uytC (C:)
    wlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelt
    everepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteya
    rkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdk
    ensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcr
    svgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshl
    tavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegre
    tesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanpn
    saetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqrdmfnevlkyg
    sfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepqgmv
    gikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskelewtearrfffw
    rlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktldd
    klkglk