PDB entry 1uyr

View 1uyr on RCSB PDB site
Description: acetyl-coa carboxylase carboxyltransferase domain in complex with inhibitor diclofop
Class: transferase
Keywords: carboxylase, carboxyltransferase, herbicide, transferase
Deposited on 2004-03-02, released 2004-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uyra1, d1uyra2
  • Chain 'B':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uyrb1, d1uyrb2
  • Heterogens: D1L, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uyrA (A:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrere
    llpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlsh
    qvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakk
    irsdhdnaidglsevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uyrA (A:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsgnev
    lkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlep
    qgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskelewtearr
    fffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyk
    tlddklkglklesfaqdlakkirsdhdnaidglsevik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uyrB (B:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrere
    llpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlsh
    qvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakk
    irsdhdnaidglsevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uyrB (B:)
    atpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneli
    edengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedef
    fnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegm
    etlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdif
    titlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqim
    ynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydv
    rwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenli
    padpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsgnevlk
    ygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepqg
    mvgikfrreklldtmnrellpiygqislqfadlhdrssrmvakgviskelewtearrfff
    wrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktld
    dklkglklesfaqdlakkirsdhdnaidglsevik