PDB entry 1uyq

View 1uyq on RCSB PDB site
Description: mutated b-glucosidase A from Paenibacillus polymyxa showing increased stability
Class: hydrolase
Keywords: hydrolase, b-glucosidase, mutation affecting stability, hydrolase glycosidase, cellulose degradation
Deposited on 2004-03-02, released 2005-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosidase a
    Species: Paenibacillus polymyxa [TaxId:1406]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22073 (0-446)
      • engineered mutation (383)
      • engineered mutation (438)
    Domains in SCOPe 2.07: d1uyqa1
  • Heterogens: G2F, NFG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uyqA (A:)
    tifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhry
    eedirlmkelgirtyrfsvswprifpngdgevnqegldyyhrvvdllndngiepfctlyh
    wdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvha
    pgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaacar
    tislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsvn
    rfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacindev
    vngkvqddrrisymqqhlvqvhraihdglhvkgymawslldnfewaegynmrfgmihvdf
    rtqvrtpkqsyywyrnvvgnnwletrr