PDB entry 1uyp

View 1uyp on RCSB PDB site
Description: the three-dimensional structure of beta-fructosidase (invertase) from thermotoga maritima
Deposited on 2004-03-02, released 2004-03-22
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-06, with a file datestamp of 2004-05-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17878
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypA (A:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypB (B:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypC (C:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypD (D:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypE (E:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uypF (F:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl