PDB entry 1uyo

View 1uyo on RCSB PDB site
Description: translocator domain of autotransporter nalp from neisseria meningitidis
Class: membrane protein
Keywords: autotransporter, translocator domain, membrane protein, outer membrane, beta-domain, beta-barrel
Deposited on 2004-03-02, released 2004-03-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.219
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: nalp
    Species: NEISSERIA MENINGITIDIS [TaxId:487]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uyox_
  • Heterogens: CXE

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1uyoX (X:)
    dgvrifnslaatvyadstaahadmqgrrlkavsdgldhngtglrviaqtqqdggtweqgg
    vegkmrgstqtvgiaaktgenttaaatlgmgrstwsensanaktdsislfagirhdagdi
    gylkglfsygryknsisrstgadehaegsvngtlmqlgalggvnvpfaatgdltvegglr
    ydllkqdafaekgsalgwsgnsltegtlvglaglklsqplsdkavlfatagverdlngrd
    ytvtggftgataatgktgarnmphtrlvaglgadvefgngwnglarysyagskqygnhsg
    rvgvgyrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uyoX (X:)
    laatvyadstaahadmqgrrlkavsdgldhtglrviaqtqqdggtwevegkmrgstqtvg
    iaaktgenttaaatlgmgrstwsensanaktdsislfagirhdagdigylkglfsygryk
    nsisrstgadehaegsvngtlmqlgalggvnvptgdltvegglrydllkqdafaekgsal
    gwsgnsltegtlvglaglklsqplsdkavlfatagverdlngrdytvtgnmphtrlvagl
    gadvefgngwnglarysyagskqygnhsgrvgvgyrf