PDB entry 1uyn

View 1uyn on RCSB PDB site
Description: translocator domain of autotransporter nalp from neisseria meningitidis
Class: membrane protein
Keywords: autotransporter, translocator domain, membrane protein, outer membrane, beta-domain, beta-barrel
Deposited on 2004-03-02, released 2004-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: nalp
    Species: NEISSERIA MENINGITIDIS [TaxId:487]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uynx_
  • Heterogens: CXE, SO4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1uynX (X:)
    dgvrifnslaatvyadstaahadmqgrrlkavsdgldhngtglrviaqtqqdggtweqgg
    vegkmrgstqtvgiaaktgenttaaatlgmgrstwsensanaktdsislfagirhdagdi
    gylkglfsygryknsisrstgadehaegsvngtlmqlgalggvnvpfaatgdltvegglr
    ydllkqdafaekgsalgwsgnsltegtlvglaglklsqplsdkavlfatagverdlngrd
    ytvtggftgataatgktgarnmphtrlvaglgadvefgngwnglarysyagskqygnhsg
    rvgvgyrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uynX (X:)
    aatvyadstaahadmqgrrlkavsdgldhngtglrviaqtqqdggtweqggvegkmrgst
    qtvgiaaktgenttaaatlgmgrstwsensanaktdsislfagirhdagdigylkglfsy
    gryknsisrstgadehaegsvngtlmqlgalggvnvptgdltvegglrydllkqdafaek
    gsalgwsgnsltegtlvglaglklsqplsdkavlfatagverdlngrdytvtgphtrlva
    glgadvefgngwnglarysyagskqygnhsgrvgvgyrf