PDB entry 1uym

View 1uym on RCSB PDB site
Description: Human Hsp90-beta with PU3 (9-Butyl-8(3,4,5-trimethoxy-benzyl)-9H-purin-6-ylamine)
Class: chaperone
Keywords: hsp90, ATPase, pu3, chaperone, ATP-binding, heat shock
Deposited on 2004-03-02, released 2004-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.4499999999999997 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock protein hsp 90-beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uyma_
  • Heterogens: PU3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uymA (A:)
    peevhhgeeevetfafqaeiaqlmsliintfysnkeiflrelisnasdaldkiryesltd
    pskldsgkelkidiipnpqertltlvdtgigmtkadlinnlgtiaksgtkafmealqaga
    dismigqfgvgfysaylvaekvvvitkhnddeqyawessaggsftvradhgepigrgtkv
    ilhlkedqteyleerrvkevvkkhsqfigypitlyleker
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uymA (A:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnasdaldkiryesltdpskldsgke
    lkidiipnpqertltlvdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvvvitkhnddeqyawessaggsftvradhgepigrgtkvilhlkedqt
    eyleerrvkevvkkhsqfigypitlyleker