PDB entry 1uyj

View 1uyj on RCSB PDB site
Description: clostridium perfringens epsilon toxin shows structural similarity with the pore forming toxin aerolysin
Class: toxin
Keywords: toxin, beta pore forming toxin
Deposited on 2004-03-02, released 2004-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23905
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epsilon-toxin
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uyja_
  • Chain 'B':
    Compound: epsilon-toxin
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uyjb_
  • Chain 'C':
    Compound: epsilon-toxin
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uyjc_
  • Heterogens: U1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uyjA (A:)
    keisntvsnemskkasydnvdtliekgryntkynylkrmekyypnamayfdkvtinpqgn
    dfyinnpkveldgepsmnyledvyvgkalltndtqqeqklksqsftckntdtvtatttht
    vgtsiqatakftvpfnetgvslttsysfantntntnskeithnvpsqdilvpanttvevi
    aylkkvnvkgnvklvgqvsgsewgeipsylafprdgykfslsdtvnksdlnedgtining
    kgnysavmgdelivkvrnlntnnvqeyvipvdkkeksndsnivkyrslsikapgik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uyjA (A:)
    sydnvdtliekgryntkynylkrmekyypnamayfdkvtinpqgndfyinnpkveldgep
    smnyledvyvgkalltndtqqeqklksqsftckntdtvtattthtvgtsiqatakftvpf
    netgvslttsysfantntntnskeithnvpsqdilvpanttveviaylkkvnvkgnvklv
    gqvsgsewgeipsylafprdgykfslsdtvnksdlnedgtiningkgnysavmgdelivk
    vrnlntnnvqeyvipvdsnivkyrslsikapgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uyjB (B:)
    keisntvsnemskkasydnvdtliekgryntkynylkrmekyypnamayfdkvtinpqgn
    dfyinnpkveldgepsmnyledvyvgkalltndtqqeqklksqsftckntdtvtatttht
    vgtsiqatakftvpfnetgvslttsysfantntntnskeithnvpsqdilvpanttvevi
    aylkkvnvkgnvklvgqvsgsewgeipsylafprdgykfslsdtvnksdlnedgtining
    kgnysavmgdelivkvrnlntnnvqeyvipvdkkeksndsnivkyrslsikapgik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uyjB (B:)
    sydnvdtliekgryntkynylkrmekyypnamayfdkvtinpqgndfyinnpkveldgep
    smnyledvyvgkalltndtqqeqklksqsftckntdtvtattthtvgtsiqatakftvpf
    netgvslttsysfantntntnskeithnvpsqdilvpanttveviaylkkvnvkgnvklv
    gqvsgsewgeipsylafprdgykfslsdtvnksdlnedgtiningkgnysavmgdelivk
    vrnlntnnvqeyvipvdsnivkyrslsikapgi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uyjC (C:)
    keisntvsnemskkasydnvdtliekgryntkynylkrmekyypnamayfdkvtinpqgn
    dfyinnpkveldgepsmnyledvyvgkalltndtqqeqklksqsftckntdtvtatttht
    vgtsiqatakftvpfnetgvslttsysfantntntnskeithnvpsqdilvpanttvevi
    aylkkvnvkgnvklvgqvsgsewgeipsylafprdgykfslsdtvnksdlnedgtining
    kgnysavmgdelivkvrnlntnnvqeyvipvdkkeksndsnivkyrslsikapgik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uyjC (C:)
    sydnvdtliekgryntkynylkrmekyypnamayfdkvtinpqgndfyinnpkveldgep
    smnyledvyvgkalltndtqqeqklksqsftckntdtvtattthtvgtsiqatakftvpf
    netgvslttsysfantntntnskeithnvpsqdilvpanttveviaylkkvnvkgnvklv
    gqvsgsewgeipsylafprdgykfslsdtvnksdlnedgtiningkgnysavmgdelivk
    vrnlntnnvqeyvipvdsnivkyrslsikapgi