PDB entry 1uy6

View 1uy6 on RCSB PDB site
Description: human hsp90-alpha with 9-butyl-8-(3,4,5-trimethoxy-benzyl)-9h-purin-6-ylamine
Class: chaperone
Keywords: hsp90, ATPase, pu3, chaperone, ATP-binding, heat shock
Deposited on 2004-03-02, released 2004-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UY6
      • conflict (62)
    • Uniprot P07900
    Domains in SCOPe 2.08: d1uy6a_
  • Heterogens: PU3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uy6A (A:)
    mpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkir
    yesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafme
    alqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepm
    grgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uy6A (A:)
    vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
    hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
    gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
    yleerrikeivkkhsqfigypitlfvek