PDB entry 1uy3

View 1uy3 on RCSB PDB site
Description: binding sub-site dissection of a family 6 carbohydrate-binding module by x-ray crystallography and isothermal titration calorimetry
Deposited on 2004-03-01, released 2004-06-18
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-18, with a file datestamp of 2004-06-18.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.13192
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uy3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uy3A (A:)
    gshmasptpapsqspirrdafsiieaeeynstnsstlqvigtpnngrgigyiengntvty
    snidfgsgatgfsatvatevntsiqirsdsptgtllgtlyvsstgswntyntvstniski
    tgvhdivlvfsgpvnvdnfifsrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uy3A (A:)
    spirrdafsiieaeeynstnsstlqvigtpnngrgigyiengntvtysnidfgsgatgfs
    atvatevntsiqirsdsptgtllgtlyvsstgswntyntvstniskitgvhdivlvfsgp
    vnvdnfifsrss