PDB entry 1uy2

View 1uy2 on RCSB PDB site
Description: Binding sub-site dissection of a family 6 carbohydrate-binding module by X-ray crystallography and isothermal titration calorimetry
Class: carbohydrate-binding module
Keywords: carbohydrate-binding module, thermodynamics, protein structure, xylan, protein-carbohydrate interactions
Deposited on 2004-03-01, released 2004-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase A
    Species: CLOSTRIDIUM STERCORARIUM [TaxId:1510]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UY2
      • conflict (110)
    • Uniprot Q93AQ5
    Domains in SCOPe 2.07: d1uy2a_
  • Heterogens: NA, CA, XYP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uy2A (A:)
    gshmasptpapsqspirrdafsiieaeeynstnsstlqvigtpnngrgigyiengntvty
    snidfgsgatgfsatvatevntsiqirsdsptgtllgtlyvsstgswntyntvstniski
    tgvhdivlvfsgpvnvdnfifsrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uy2A (A:)
    spirrdafsiieaeeynstnsstlqvigtpnngrgigyiengntvtysnidfgsgatgfs
    atvatevntsiqirsdsptgtllgtlyvsstgswntyntvstniskitgvhdivlvfsgp
    vnvdnfifsrs